Application
Anti-MAP3K2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.
Biochem/physiol Actions
MAP Kinase Kinase Kinase 2 (MAP3K2; MEKK2) belongs to a family of enzymes that activates their substrate by dual phosphorylation at serine and threonine residues. MAP3K2 activates the kinases involved in the MAPK signaling pathway. It activates Iκ B kinases that are important regulators of NF-κB pathway. This kinase also facilitates cross-talk between c- Jun and FAK and MAPK and activates several downstream targets that contribute to cell proliferation, inflammation apoptosis and motility.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human MAP3K2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE
This product has met the following criteria to qualify for the following awards: