Anti-MAF1

Code: SAB2106907-100UL D2-231

Biochem/physiol Actions

Maf1 is an element of the mTORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. It ...


 Read more

Your Price
€519.00 100UL
€638.37 inc. VAT

Biochem/physiol Actions

Maf1 is an element of the mTORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. It inhibits the de novo assembly of TFIIIB onto DNA.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

The immunogen for anti-MAF1 antibody: synthetic peptide derected towards the N terminal of human MAF1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HVLEALSPPQTSGLSPSRLSKSQGGEDESPLSDKCSRKTLFYLIATLNES

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MAF1(84232)mouse ... Maf1(68877)
mol wt28 kDa
NCBI accession no.NM_001164607
Quality Level100
shipped inwet ice
species reactivityhorse, human, bovine, guinea pig, rat, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9D0U6
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.