Anti-LACTB

Code: AV52431-100UL D2-231

Biochem/physiol Actions

LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some seq...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Biochem/physiol Actions

LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.This gene encodes a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). The encoded protein has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human LACTB

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LACTB(114294)
mol wt61 kDa
NCBI accession no.NP_116246
Quality Level100
shipped inwet ice
species reactivityguinea pig, rat, bovine, horse, human, mouse, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P83111
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.