Application
Rabbit anti-KLHL14 antibody is suitable for western blot assays and for IHC assays at 4-8 μg/ml.
Biochem/physiol Actions
KLHL14 is a member of the KLHL family.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
KLHL14 is a protein member of the kelch-like family. Rabbit anti-KLHL14 antibody recognizes chicken, canine, bovine, human, mouse, and rat KLHL14.
Immunogen
Synthetic peptide directed towards the N terminal region of human KLHL14
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV
This product has met the following criteria to qualify for the following awards: