Anti-KLF9

Code: AV31369-100UL D2-231

Application

Rabbit Anti-KLF9 antibody is suitable for use in western blot (1.0µg/ml) and IHC (4-8µg/ml) applications.

Biochem/physiol Actions...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Application

Rabbit Anti-KLF9 antibody is suitable for use in western blot (1.0µg/ml) and IHC (4-8µg/ml) applications.

Biochem/physiol Actions

KLF9 is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Kruppel-like factor 9 (KLF9) is a transcription factor that regulates several functions such as central nervous systems (CNS) development, villus cell movement, intestinal cell proliferation, and PPARγ-mediated adipocyte differentiation. Furthermore, KLF9 also regulates the differentiation, adhesion and growth of endometrial cells and has been implicated in endometrial carcinoma.Rabbit Anti-KLF9 antibody recognizes pig, bovine, human, mouse, and rat KLF9.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human KLF9

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... KLF9(687)
mol wt27 kDa
NCBI accession no.NP_001197
Quality Level100
shipped inwet ice
species reactivityrat, horse, guinea pig, bovine, rabbit, mouse, human
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q13886
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.