Application
Rabbit Anti-KCNK13 antibody is suitable for IHC (4-8 ug/ml) and western blot (0.12 µg/ml) applications.
Biochem/physiol Actions
KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
KCNK13 (THIK1) is a potassium channel that belongs to the K subfamily. It can be activated by arachidonic acid and blocked by halothane.Rabbit Anti-KCNK13 antibody reacts with rat and human KCNK13.
Immunogen
Synthetic peptide directed towards the C terminal region of human KCNK13
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA
This product has met the following criteria to qualify for the following awards: