Application
Anti-ITGBL1 (AB1) polyclonal antibody is used to tag integrin, β-like 1 (with EGF-like repeat domains) protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of integrin, β-like 1 (with EGF-like repeat domains) in cell processes such as isolated growth hormone deficiency
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Integrin, β-like 1 (with EGF-like repeat domains) (ITGBL1, TIED) is a β integrin-related protein found in aorta, thymus and osteogenic sarcoma. Defects in ITGBL1 may be associated with isolated growth hormone deficiency.
Immunogen
Synthetic peptide directed towards the N terminal region of human ITGBL1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR
Specificity
Anti-ITGBL1 (AB1) polyclonal antibody reacts with canine, human, bovine, mouse, and rat integrin, β-like 1 (with EGF-like repeat domains) proteins.
This product has met the following criteria to qualify for the following awards: