ANTI-IHH

Code: SAB2108031-100UL D2-231

Biochem/physiol Actions

IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which function...


 Read more

Your Price
€412.00 100UL
€506.76 inc. VAT

Biochem/physiol Actions

IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human IHH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... IHH(3549)
mol wt45kDa
NCBI accession no.NM_002181
Quality Level100
shipped inwet ice
species reactivityrat, guinea pig, rabbit, mouse, human
storage temp.−20°C
technique(s)immunoblotting: suitable, immunohistochemistry: suitable
UniProt accession no.Q14623
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.