Application
Anti-IFIT3 polyclonal antibody is used to tag interferon-induced protein with tetratricopeptide repeats 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and level of interferon-induced protein with tetratricopeptide repeats 3 in cells responding to interferon induction such as occurs during RNA virus infection.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Interferon-induced protein with tetratricopeptide repeats 3 (IFIT3) is an interferon-stimulated gene induced by RNA virus infections, lipopolysaccharides and double-stranded RNA. IFIT3 and its family members (IFIT1, IFIT2, IFIT5) are involved in protein:protein interactions the a effect processes such as translation initiation, virus replication, cell migration, proliferation and ds-RNA signaling.
Immunogen
Synthetic peptide directed towards the N terminal region of human IFIT3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY
Specificity
Anti-IFIT3 polyclonal antibody reacts with human, mouse, bovine, and rat interferon-induced protein with tetratricopeptide repeats 3 proteins.
This product has met the following criteria to qualify for the following awards: