Application

Rabbit Anti-HSF4 antibody can be used for western blot applications at a concentration of 5µg/ml.

Biochem/physiol Actions

Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

HSF4 is a transcription factor that represses the expression of genes coding for heat shock proteins and molecular chaperones. Studies in mice have reported that HSF4 regulates the growth and differentiation of mouse cells.Rabbit Anti-HSF4 antibody recognizes human HSF4.

Immunogen

Synthetic peptide directed towards the middle region of human HSF4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSCPT