Anti-FAU

Code: AV54604-100UL D2-231

Application

Anti-FAU antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

FAU ...


 Read more

Your Price
€397.00 100UL
€488.31 inc. VAT

Application

Anti-FAU antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

FAU (FBR-MuSV associated ubiquitously expressed gene) gene is the cellular counterpart of the fox sequence present in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). FAU gene is mapped on to chromosome 11 at 11q13 and is ubiquitously expressed. It encodes a fusion protein comprising ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. Fubi belongs to ubiquitin family whereas ribosomal protein S30 is a member of S30E family of ribosomal proteins. S30 is a component of 40S ribosomal subunit and facilitates the antimicrobial activity. FAU gene is a pro-apoptotic regulatory gene that augments basal apoptosis in human T-cell lines and 293T/17 cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human FAU

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FAU(2197)
mol wt14 kDa
NCBI accession no.NP_001988
Quality Level100
shipped inwet ice
species reactivitybovine, rat, mouse, guinea pig, rabbit, human, dog, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P62861
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.