Anti-ELF1

Code: AV31085-100UL D2-231

Application

Rabbit Anti-ELF1 (AB2) antibody is suitable for use in western blot (1µg/ml) applications.

Biochem/physiol Actions

ELF1 belongs ...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Application

Rabbit Anti-ELF1 (AB2) antibody is suitable for use in western blot (1µg/ml) applications.

Biochem/physiol Actions

ELF1 belongs to the ETS family. It contains 1 ETS DNA-binding domain. ELF1 is a transcription factor that activates the LYN and BLK promoters. It appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. ELF1 binds specifically to two purine-rich motifs in the HIV-2 enhancer.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ELF1 is known to function as a transcription factor that regulates the Tie2 gene during blood vessel development. Elf1 has also been implicated in the regulation of terminal transferase gene.Rabbit Anti-ELF1 (AB2) antibody recognizes rat, human, bovine, canine, and mouse ELF1.

Immunogen

Synthetic peptide directed towards the N terminal region of human ELF1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ELF1(1997)
mol wt67 kDa
NCBI accession no.NP_758961
Quality Level100
shipped inwet ice
species reactivityhorse, human, rabbit, dog, bovine, rat, guinea pig
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P32519
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.