Anti-EIF4E3

Code: AV41168-100UL D2-231

Application

Anti-EIF4E3 polyclonal antibody is used to tag eukaryotic translation initiation factor 4E family member 3 proteins for detection and quantitation by Western blot...


read more

Your Price
€508.00 100UL
€624.84 inc. VAT

Application

Anti-EIF4E3 polyclonal antibody is used to tag eukaryotic translation initiation factor 4E family member 3 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of eukaryotic translation initiation factor 4E family member 3 in the initiation of mRNA translation.

Biochem/physiol Actions

EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Eukaryotic translation initiation factor 4E family member 3 (EIF4E3) is a member of the eukaryotic translation initiation factor 4E (eIF4E) family involved in the initiation of mRNA translation by binding to its 5’;-prime cap structure and targeting the mRNA to the ribosome.

Immunogen

Synthetic peptide directed towards the middle region of human EIF4E3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH

Specificity

Anti-EIF4E3 polyclonal antibody reacts with chicken, human, mouse, rat, bovine, and zebrafish eukaryotic translation initiation factor 4E family member 3 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... EIF4E3(317649)
mol wt24 kDa
NCBI accession no.NP_001128121
Quality Level100
shipped inwet ice
species reactivityhorse, dog, guinea pig, rabbit, rat, mouse, bovine, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8N5X7
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.