Biochem/physiol Actions
IF4B contains 1 RRM (RNA recognition motif) domain and is required for the binding of mRNA to ribosomes. Functions of EIF4B are in close association with EEF4-F and EIF4-A. It binds near the 5′-terminal cap of mRNA in presence of EIF-4F and ATP and promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human EIF4B
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQ
This product has met the following criteria to qualify for the following awards: