Biochem/physiol Actions
The gene CTBP2 (C-terminal binding protein 2) encodes a protein that functions as a transcriptional co-repressor of several tumor suppressor genes resulting in enhanced cancer cell migration and invasion. Its expression is found to be upregulated in hepatocellular carcinoma (HCC). It may be a potential prognostic marker for post liver resection HCC. It is involved in several types of tumor initiation, progression and response to therapy. It is found to interact with the C-terminal region of adenovirus type 2/5 E1A protein, a region that negatively regulates tumorigenicity and the extent of oncogenic transformation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
The gene CTBP2 (C-terminal binding protein 2) encodes a member of the CtBP-family. The gene is mapped to human chromosome 21q21.3. It is found to be expressed ubiquitously, with higher expression in the heart, skeletal muscle, and pancreas.
Immunogen
Synthetic peptide directed towards the C terminal region of human CTBP2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA
This product has met the following criteria to qualify for the following awards: