Anti-CHRNA7

Code: AV35418-100UL D2-231

Biochem/physiol Actions

The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, ...


 Read more

Your Price
€350.00 100UL
€430.50 inc. VAT

Biochem/physiol Actions

The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Neuronal acetylcholine receptor subunit α-7 (CHRNA7 or NACHRA7) is a subunit of a member of the nicotinic acetylcholine receptor family. These proteins are hetero-pentamers composed of homologous subunits. Upon acetylcholine binding the receptor undergoes a conformational change resulting in an open ion channel. CHRNA7 is found highly expressed in the hippocampus localized to GABAergic neurons.

Immunogen

Synthetic peptide directed towards the middle region of human CHRNA7

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CHRNA7(89832)
mol wt56 kDa
NCBI accession no.XP_001717927
Quality Level100
shipped inwet ice
species reactivitybovine, horse, human, guinea pig, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P36544
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.