Application
Rabbit Anti-CHEK1 antibody can be used for western blot applications at a concentration of 0.5µg/ml. It can also be used for immunohistochemistry at 4-8µg/ml.
Biochem/physiol Actions
CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
CHEK1 is a serine/threonine kinase that functions as a sensor for the stress response pathway in cells. It is activated by ATR kinase phosphorylation in response to DNA damage, and can subsequently modulate p53 phosphorylation. CHEK1 activity is inhibited by BCL6 in B cells.Rabbit Anti-CHEK1 antibody recognizes zebrafish, bovine, chicken, human, mouse, rat, and canine CHEK1.
Immunogen
Synthetic peptide directed towards the middle region of human CHEK1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL
This product has met the following criteria to qualify for the following awards: