Anti-CHAC1

Code: AV42623-100UL D2-231

Application

Anti-CHAC1 polyclonal antibody is used to tag cation transport regulator-like protein 1 proteins for detection and quantitation by Western blotting and in cells a...


 Read more

Your Price
€481.00 100UL
€591.63 inc. VAT

Application

Anti-CHAC1 polyclonal antibody is used to tag cation transport regulator-like protein 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of CHAC1 in the regulation of apoptosis via the unfolded protein response pathway.

Biochem/physiol Actions

CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CHAC1/MGC4504 (cation transport regulator-like protein 1), a novel gene regulated by the atherosclerotic lesion component ox-PAPC (oxidized 1-palmitoyl-2-arachidonyl-sn-3-glycero-phosphorylcholine), is a proapoptotic component of the ATF4-ATF3-CHOP cascade mediating the unfolded protein response pathway within cells.

Immunogen

Synthetic peptide directed towards the C terminal region of human CHAC1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD

Specificity

Anti-CHAC1 polyclonal antibody reacts with human, canine, bovine, rat, mouse, mouse, rat, and human cation transport regulator-like protein 1 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CHAC1(79094)
mol wt24 kDa
NCBI accession no.NP_077016
Quality Level100
shipped inwet ice
species reactivityrabbit, dog, mouse, bovine, human, rat, horse, pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9BUX1
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.