Application
Anti-CHAC1 polyclonal antibody is used to tag cation transport regulator-like protein 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of CHAC1 in the regulation of apoptosis via the unfolded protein response pathway.
Biochem/physiol Actions
CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
CHAC1/MGC4504 (cation transport regulator-like protein 1), a novel gene regulated by the atherosclerotic lesion component ox-PAPC (oxidized 1-palmitoyl-2-arachidonyl-sn-3-glycero-phosphorylcholine), is a proapoptotic component of the ATF4-ATF3-CHOP cascade mediating the unfolded protein response pathway within cells.
Immunogen
Synthetic peptide directed towards the C terminal region of human CHAC1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
Specificity
Anti-CHAC1 polyclonal antibody reacts with human, canine, bovine, rat, mouse, mouse, rat, and human cation transport regulator-like protein 1 proteins.
This product has met the following criteria to qualify for the following awards: