Application
Anti-CDKN2B antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.
Biochem/physiol Actions
CDKN2B has inhibitory effects on cell cycle progression. It binds to cyclin-dependent kinases and prevents their association with D-type cyclins. Methylation of CDKN2B has been associated with pathogenesis of pediatric myelodysplastic syndromes and in malignant hematopoiesis. Mutations in CDKN2B gene have been observed in malignant gliomas.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human CDKN2B
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
This product has met the following criteria to qualify for the following awards: