Anti-CASP8AP2

Code: AV50555-100UL D2-231

Application

Rabbit Anti-CASP8AP2 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

CA...


read more

Your Price
€588.00 100UL
€723.24 inc. VAT

Application

Rabbit Anti-CASP8AP2 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

CASP8AP2 is highly similar to FLASH, a mouse apoptotic protein identified by its interaction with the death-effector domain (DED) of caspase 8. Studies of FLASH protein suggested that this protein may be a component of the death-inducing signaling complex that includes Fas receptor, Fas-binding adapter FADD, and caspase 8, and plays a regulatory role in Fas-mediated apoptosis.This protein is highly similar to FLASH, a mouse apoptotic protein identified by its interaction with the death-effector domain (DED) of caspase 8. Studies of FLASH protein suggested that this protein may be a component of the death-inducing signaling complex that includes Fas receptor, Fas-binding adapter FADD, and caspase 8, and plays a regulatory role in Fas-mediated apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CASP8AP2 codes for caspase 8 associated protein 2 and it may be implicated in apoptosis. This gene has been studied as a prognostic biomarker in pediatric acute lymphoblastic leukemia.Rabbit Anti-CASP8AP2 antibody recognizes canine, bovine, human, mouse, and rat CASSP8AP2.

Immunogen

Synthetic peptide directed towards the N terminal region of human CASP8AP2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SLKKNISALIKTARVEINRKDEEISNLHQRLSEFPHFRNNHKTARTFDTV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CASP8AP2(9994)
mol wt223 kDa
NCBI accession no.NP_001131140
Quality Level100
shipped inwet ice
species reactivityhuman, rat, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9UKL3
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.