Application
Anti-ATOH8 polyclonal antibody is used to tag atonal homolog 8 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of Atonal homolog 8 in tissue-specific differentiation during embryogenesis.
Biochem/physiol Actions
The function of ATOH8 remains unknown.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Atonal homolog 8 (Drosophila) (ATOH8) is a basic helix-loop-helix (bHLH) transcription factor involved in the vertebrae tissue-specific differentiation of the nervous system, kidneys, pancreas, retina and muscle during embryogenesis.
Immunogen
Synthetic peptide directed towards the N terminal region of human ATOH8
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL
Specificity
Anti-ATOH8 polyclonal antibody reacts with canine, human, mouse, and rat atonal homolog 8 proteins.
This product has met the following criteria to qualify for the following awards: