Application
Rabbit Anti-ATF1 (AB2) antibody can be used for western blotting (0.5µg/ml) applications.
Biochem/physiol Actions
ATF1 binds the cAMP response element (CRE) (consensus: 5′-GTGACGT [AC] [AG]-3′), a sequence present in many viral and cellular promoters. ATF1 binds to the Tax-responsive element (TRE) of HTLV-I. ATF1 mediates PKA-induced stimulation of CRE-reporter genes.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ATF1 is a member of the AMP response element-binding protein/activating transcription factor (CREB/ATF) that associates with BRCA1. ATF1 target genes have been implicated in mediating transcriptional response to DNA damage. Moreover, studies have reported that phosphorylation of ATF1 is needed for growth factor-induced expression of c-jun.Rabbit Anti-ATF1 (AB2) antibody recognizes rat, mouse, zebrafish, bovine, and human ATF1.
Immunogen
Synthetic peptide directed towards the middle region of human ATF1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR
This product has met the following criteria to qualify for the following awards: