Application
Rabbit Anti-ARID3A antibody can be used for western blot assays at 0.25µg/ml.
Biochem/physiol Actions
ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ARID3A is a transcription factor that is involved in somatic cell reprograming. This transcription factor has also been implicated in chromatin assembly and developmental plasticity.Rabbit Anti-ARID3A antibody recognizes bovine, human, mouse, rat, and canine ARID3A.
Immunogen
Synthetic peptide directed towards the middle region of human ARID3A
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG
This product has met the following criteria to qualify for the following awards: