Anti-AMFR

Code: AV42995-100UL D2-231

Biochem/physiol Actions

Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. AMFR is a glycosylated transmembrane protein and a receptor...


read more

Your Price
€396.00 100UL
€396.00 inc. VAT

Biochem/physiol Actions

Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. AMFR is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells.The Makorin ring finger protein-1 gene (MKRN1) is a highly transcribed, intron-containing source for a family of intronless mammalian genes encoding a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family (Gray et al., 2000).[supplied by OMIM].

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human AMFR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... AMFR(267)
mol wt73 kDa
NCBI accession no.NP_001135
Quality Level100
shipped inwet ice
species reactivityrat, rabbit, bovine, guinea pig, mouse, human, dog, horse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9UKV5
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.