Anti-ALOX15B

Code: AV41895-100UL D2-231

Application

Anti-ALOX15B polyclonal antibody is used to tag arachidonate 15-lipoxygenase, type B proteins for detection and quantitation by Western blotting and in cells and ...


read more

Your Price
€388.00 100UL
€477.24 inc. VAT

Application

Anti-ALOX15B polyclonal antibody is used to tag arachidonate 15-lipoxygenase, type B proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of ALOX15B in inflammatory disorders.

Biochem/physiol Actions

ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Arachidonate 15-lipoxygenase, type B (ALOX15B) is an arachidonate metabolizing enzyme that catalyzes the oxidation of arachidonate to (5Z,8Z,11Z,13E)-(15S)-15-hydroperoxyicosa-5,8,11,13-tetraenoate (15-HPETE). Arachidonate 15-lipoxygenases and its products are implicated in the pathogenesis of a variety of inflammatory disorders such as arthritis, psoriasis, and asthma.

Immunogen

Synthetic peptide directed towards the C terminal region of human ALOX15B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR

Specificity

Anti-ALOX15B polyclonal antibody reacts with bovine, human, mouse, rat, and canine arachidonate 15-lipoxygenase, type B.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ALOX15B(247)
mol wt74 kDa
NCBI accession no.NP_001034219
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O15296
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.