AV44463-100UL Display Image

Anti-ALG11

Code: AV44463-100UL D2-231

Application

Anti-ALG11 antibody is used to tag asparagine-linked glycosylation 11 homolog proteins for detection and quantitation by Western blotting and in cells and tissues...


read more

Your Price
€587.01 100UL

Application

Anti-ALG11 antibody is used to tag asparagine-linked glycosylation 11 homolog proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of this mannosyltransferase in disorders such as congenital disorder of glycosylation-Ip.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Asparagine-linked glycosylation 11 homolog (ALG11), GDP-Man:Man3GlcNAc2-PP-dolichol-A1,2-mannosyltransferase, is a mannosyltransferase which catalyzes A 1,2-mannosylations of N-linked glycans during protein glycosylation within the endoplasmic reticulum (ER).

Immunogen

Synthetic peptide directed towards the C terminal region of human ALG11

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES

Specificity

Anti-ALG11 antibody reacts with zebrafish, canine, human, mouse, rat, bovine, and chicken asparagine-linked glycosylation 11 homolog (ALG11p).

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ALG11(440138)
mol wt56 kDa
NCBI accession no.NP_001004127
Quality Level100
shipped inwet ice
species reactivitymouse, human, horse, rat
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q2TAA5
Quantity
Est. Dispatch/Availability