Application
Anti-ALG11 antibody is used to tag asparagine-linked glycosylation 11 homolog proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of this mannosyltransferase in disorders such as congenital disorder of glycosylation-Ip.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Asparagine-linked glycosylation 11 homolog (ALG11), GDP-Man:Man3GlcNAc2-PP-dolichol-A1,2-mannosyltransferase, is a mannosyltransferase which catalyzes A 1,2-mannosylations of N-linked glycans during protein glycosylation within the endoplasmic reticulum (ER).
Immunogen
Synthetic peptide directed towards the C terminal region of human ALG11
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES
Specificity
Anti-ALG11 antibody reacts with zebrafish, canine, human, mouse, rat, bovine, and chicken asparagine-linked glycosylation 11 homolog (ALG11p).
Quantity
Est. Dispatch/Availability