Application
Anti-alcohol dehydrogenase 4 is a rabbit IgG polyclonal antibody used to tag alcohol dehydrogenase-4 protein(s) for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques.
Biochem/physiol Actions
ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Alcohol dehydrogenase 4 is an enzyme that metabolized a variety of substrates including ethanol, retinol, aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Alcohol dehydrogenase 4 is found in the liver.
Immunogen
Synthetic peptide directed towards the middle region of human ADH4
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET
Specificity
Anti-alcohol dehydrogenase 4 recognizes the pi-subunit of human ADH-4.
This product has met the following criteria to qualify for the following awards: