Anti-TNNI2

Code: av51270-100ul D2-231

Application

Anti-TNNI2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml.

Biochem/physiol Actions


 Read more

Your Price
€432.00 100UL
€531.36 inc. VAT

Application

Anti-TNNI2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml.

Biochem/physiol Actions

Troponin I type 2 (TNNI2) is a fast-twitch muscle protein belonging to the troponin I gene family. It forms a complex that regulates striated muscle contraction along with troponins T and C. TNNI2 also has a role in smooth muscle contraction, angiogenesis, metastasis and tumor growth. Mutations in TNNI2 gene have been implicated in myopathy1 and distal arthrogryposis type 2B.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human TNNI2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TNNI2(7136)
mol wt21 kDa
NCBI accession no.NP_003273
Quality Level100
shipped inwet ice
species reactivitygoat, guinea pig, rat, horse, bovine, rabbit, human, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P48788
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.