Anti-ST6GALNAC6

Code: av46950-100ul D2-231

Application

Anti-ST6GALNAC6 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/mL.

Biochem/physiol Actions

 Read more

Your Price
€449.00 100UL
€552.27 inc. VAT

Application

Anti-ST6GALNAC6 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/mL.

Biochem/physiol Actions

ST6GALNAC6 [ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6] gene encodes a single-pass type II membrane protein that belongs to glycosyltransferase 29 family and is primarily expressed in kidney, in proximal tubule epithelial cells and colon cell lines. It plays a crucial role in biosynthesis of DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside) in normal and malignant kidney. It is also involved in the synthesis of disialyl Lewis a (Lea).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human ST6GALNAC6

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ST6GALNAC6(30815)
mol wt38 kDa
NCBI accession no.NP_038471
Quality Level100
shipped inwet ice
species reactivityhuman, mouse, dog, guinea pig, horse, rat, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q969X2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.