Biochem/physiol Actions

PBXIP1 is the regulator of pre-B-cell leukemia transcription factors (BPXs) function. It inhibits the binding of PBX1-HOX complex to DNA and blocks the transcriptional activity of E2A-PBX1. PBXIP1 tethers estrogen receptor-alpha (ESR1) to microtubules and allows them to influence estrogen receptors-alpha signaling.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human PBXIP1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AGGEGAGGELGISLNMCLLGALVLLGLGVLLFSGGLSESETGPMEEVERQ