Application

Anti-NAGS antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml.

Biochem/physiol Actions

N-acetylglutamate synthase (NAGS) is a mitochondrial enzyme that catalyzes the reaction between glutamate and acetyl coenzyme-A to form N-acetylglutamate. NAG regulates ureagenesis since it is the cofactor of the enzyme (carbamyl phosphate synthetase I) that catalyzes the first step of the urea cycle. Deficiency of NAGS results in hyperammonemia.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human NAGS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD