Application

Anti-FOS produced in rabbit is suitable for western blotting at a concentration of 1.25 µg/ml.

Biochem/physiol Actions

c-Fos is a trans-acting factor that does not directly bind DNA. It interacts with AP-1 transcription factor, a step that is prerequisite for c-Fos-mediated gene expression. The role of c-Fos has been studied in activation of neurons, oncogenesis and inflammation of bone and skin.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

c-Fos is an inducible transcription factor and a functional marker of activated neurons. It is induced in response to neurotransmitters and growth factors.

Immunogen

Synthetic peptide directed towards the C terminal region of human FOS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: CTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLA