Application

Rabbit Anti-ZNF609 antibody can be used for western blot applications at a concentration of 1.25µg/ml.

Biochem/physiol Actions

The function of ZNF609 remains unknown.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZNF609 is a zinc-finger protein that may function as a p53-regulated target.Rabbit Anti-ZNF609 antibody recognizes chicken, human, bovine, mouse, and rat ZNF609.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZNF609

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: NIKFVTPVPGPQGKEGKSKSKRSKSGKDTSKPTPGTSLFTPSEGAASKKE