Application

Anti-ZDHHC16 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

Zinc finger, DHHC-type containing 16 (ZDHHC16; APH2; DHHC-16) is c-Abl interacting protein that is localized to endoplasmic reticulum. It may be involved in ER stress-induced apoptosis and exhibit pro-apoptotic activity. It may also interact with JAB1 protein and negatively regulate the activation of AP-1.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZDHHC16

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC