Application

Rabbit Anti-TCFL5 antibody can be used for western blot assays at a concentration of 2.0µg/ml. The antibody product can also be used for IHC applications (4-8µg/ml, using paraffin-embedded tissues).

Biochem/physiol Actions

TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

TCFL5 is a basic helix-loop-helix (bHLH) protein that is expressed in primary spermatocytes. Studies in mice have revealed that Tcfl5 associated with the Calmegin gene promoter during spermatogenesis.Rabbit Anti-TCFL5 antibody recognizes mouse and human TCFL5.

Immunogen

Synthetic peptide directed towards the middle region of human TCFL5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS