Application

Anti-PRIM2 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0µg/ml.

Biochem/physiol Actions

PRIM2 is a DNA primase that acts as DNA-directed RNA polymerase and synthesizes small RNA primers. These primers, termed Okazaki fragments are crucial for the replication of lagging DNA strand.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human PRIM2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS