Application

Rabbit Anti-LEF1 (AB2) antibody can be used for western blot (2µg/ml) and IHC (4-8µg/ml, using paraffin-embedded tissues) applications.

Biochem/physiol Actions

Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

LEF1 is a transcription factor that interacts with β-catenin and modulates cell adhesion. This transcription factor also mediates nuclear responses via the Wnt signaling pathway.Rabbit Anti-LEF1 (AB2) antibody recognizes chicken, human, mouse, rat, canine, rabbit, bovine, zebrafish, and pig LEF1.

Immunogen

Synthetic peptide directed towards the C terminal region of human LEF1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ