Anti-FAM3C

Code: AV44904-100UL D2-231

Application

Anti-FAM3C antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

...


 Read more

Your Price
€449.00 100UL
€449.00 inc. VAT

Application

Anti-FAM3C antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

FAM3C belongs to the family with sequence similarity 3 (FAM3) family and is a secreted cytokine that promotes epithelial to mesenchymal transition, metastasis and tumor formation in the epithelial cells. The activity of FAM3C is essential for formation of retinal lamina and the development of retina.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human FAM3C

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FAM3C(10447)
mol wt22 kDa
NCBI accession no.NP_001035109
Quality Level100
shipped inwet ice
species reactivitydog, rat, human, bovine, guinea pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q92520
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.