Anti-APOA1

Code: SAB2107051-100UL D2-231

Biochem/physiol Actions

Apoa1 is a major component of high density lipoprotein (HDL) that is involved in intercellular cholesterol transport in astrocytes; cofactor for lecit...


 Read more

Your Price
€513.00 100UL
€630.99 inc. VAT

Biochem/physiol Actions

Apoa1 is a major component of high density lipoprotein (HDL) that is involved in intercellular cholesterol transport in astrocytes; cofactor for lecithin cholesterolacyltransferase (LCAT)。

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

The immunogen for anti-APOA1 antibody: synthetic peptide derected towards the N terminal of human APOA1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LVFLTGCQAWEFWQQDEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... APOA1(335)
mol wt30 kDa
NCBI accession no.NM_012738
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P04639
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.