Anti-MAN1A2

Code: SAB2101422-100UL D2-231

Biochem/physiol Actions

Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information.Alpha-manno...


read more

Your Price
€577.00 100UL
€709.71 inc. VAT

Biochem/physiol Actions

Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information.Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-597 BC052954.1 17-613 598-1023 AU133800.1 118-543 1024-2908 AF027156.1 823-2707 2909-3316 BC052954.1 2925-3332 3317-4416 BC063300.1 3315-4414 4417-5388 BC052954.1 4432-5403

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human MAN1A2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MAN1A2(10905)
mol wt73 kDa
Quality Level100
shipped inwet ice
species reactivityguinea pig, rabbit, dog, mouse, rat, human, bovine, horse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O60476
This product has met the following criteria: