Anti-CAV3

Code: AV09021-100UL D2-231

Application

Anti-CAV3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 µg/ml.

Biochem/physiol Actions

...


 Read more

Your Price
€455.00 100UL
€559.65 inc. VAT

Application

Anti-CAV3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 µg/ml.

Biochem/physiol Actions

Caveolin-3 is a membrane protein that binds to the Ca(2+)-release channel, RyR1 and facilitates caveolae formation and Ca+2 homeostasis. CAV3 regulates human ether-a-go-go-related gene (hERG) channels that controls cardiac repolarization.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human CAV3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG

Target description

CAV-3 is a meber of the caveolin family of proteins. It functions as a scaffolding protein caveolin-interacting components and is found highly expressed in muscle.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CAV3(859)
mol wt17 kDa
NCBI accession no.NP_203123
Quality Level100
shipped inwet ice
species reactivityhuman, bovine
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P56539
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.